Klinik für Frauenheilkunde und Geburtshilfe - Lehrstuhl der Universität Regensburg

FORSCHUNGS-PROJEKTE -2-

icb-1

Das humane Gen icb-1 wurde vom AG-Leiter Dr. Treeck im Jahre 1998 entdeckt. Icb-1 ist als ORF 38 auf Chromosom 1 lokalisiert, daher wird das Gen alternativ auch als C1ORF38 bezeichnet. Icb-1 wird in einer grossen Vielzahl von humanen Geweben in verschiedenen Splice-Varianten exprimiert. Die Expression von icb-1 wird im Laufe von in vitro Differenzierungsprozessen von Tumorzellen aktiviert, ausgelöst durch ECM-Kontakt im Falle endometrialer Adenokarzinomzellen oder durch Vitamin D3 oder Retinolsäure bei Leukämiezellen. Daher ist icb-1 ein mögliches Ziel für eine gerichtete Tumor-Therapie. Dieses Gen wird auch durch Interferon gamma in Ovarialkarzinomzellen aktiviert, wobei der Knockdown von icb-1 die Wirkung des Interferons noch verstärkt. Kürzlich konnte in unserem Labor gezeigt werden, dass icb-1 auch ein Zielgen von Östrogen-Stimuli ist und sogar ein putatives Estrogen response element in seinem Promotor enthält. Die momentan laufenden Experimente dienen der Aufklärung der Bedeutung von icb-1 im Östrogen-Signalsystem und bei der Differenzierung von Mammakarzinomzellen.

Link zum icb-1 Gen: Ensembl-Eintrag von icb-1

 

ICB-1 Protein- Sequenz

      

            1 MEPVPLQDFVRALDPASLPRVLRVCSGVYFE G SIYEISGNECCLSTGDLIKVTQVRLQKV
    61 VCENPKTSQTMELAPNFQG YFTPLNTPQSYETLEELVSATTQSSKQLPTCFMSTHRIVTE
   121 GRVVTEDQLLMLEAVVMHLGIRSARCVLGMEGQQVILHLPLSQKGPFWTWEPSAPRTLLQ
   181 VLQDPALKDLVLTCPTLPWHSLILRPQYEIQAIMHM RRTIVKIPSTLEVDVEDVTASSRH
   241 VHFIKPLLLSE RLSDQAGEDEEEECKEEAESPERVLLPFHFPGSFVEEMSDSRRYSLADL
   301 TAQFSLPCEVKVVAKDTSHPTDPLTSFLGLRLEEKITEPFLVVSLDSEPGMCFEIPPRWL
   361 DLTVVKAKGQPDLPEGSLPIATVEELTDTFYYRLRKLPACEIQAPPPRPPKNQGLSKQRR
   421 HSSEGGVKSSQVLGLQQHARLPKPKAKTLPEFIKDGSSTYSKIPAHRKGHRPAKPQRQDL
   481 DDDEHDYEEILEQFQKTI

 

 

ICB-1 Transkript-Sequenz

AGTCTGAGCCCAGAGAGCCGCGGGGACCATGGAGCCGGTGCCGCTGCAGGACTTCGTGCG
............................-M--E--P--V--P--L--Q--D--F--V--R

                                                           
CGCCTTGGACCCCGCCTCCCTCCCGCGCGTGCTGCGGGTCTGCTCGGGGGTCTACTTCGA
--A--L--D--P--A--S--L--P--R--V--L--R--V--C--S--G--V--Y--F--E

                                                           
GGGCTCCATCTATGAGATCTCTGGGAATGAGTGCTGCCTCTCCACGGGGGACCTGATCAA
--G--S--I--Y--E--I--S--G--N--E--C--C--L--S--T--G--D--L--I--K

                                                           
GGTCACCCAGGTCCGCCTCCAGAAGGTGGTCTGTGAGAACCCGAAGACCAGCCAGACCAT
--V--T--Q--V--R--L--Q--K--V--V--C--E--N--P--K--T--S--Q--T--M

                                                           
GGAGCTCGCCCCCAACTTCCAGGGCTACTTCACCCCCCTCAACACCCCACAGAGCTATGA
--E--L--A--P--N--F--Q--G--Y--F--T--P--L--N--T--P--Q--S--Y--E

                                                          Y
AACCCTGGAGGAGCTGGTCTCTGCCACAACTCAGAGCTCCAAGCAGCTGCCCACTTGCTT
--T--L--E--E--L--V--S--A--T--T--Q--S--S--K--Q--L--P--T--C-=F

                                                           
CATGTCGACCCACAGGATTGTCACAGAGGGCAGGGTGGTGACTGAGGACCAGCTCCTCAT
=-M--S--T--H--R--I--V--T--E--G--R--V--V--T--E--D--Q--L--L--M

                                                           
GCTTGAGGCTGTGGTGATGCACCTCGGGATCCGCTCTGCCCGCTGTGTCCTGGGCATGGA
--L--E--A--V--V--M--H--L--G--I--R--S--A--R--C--V--L--G--M--E

                                                           
GGGTCAGCAGGTCATCCTGCACCTGCCCCTATCCCAGAAGGGGCCCTTCTGGACATGGGA
--G--Q--Q--V--I--L--H--L--P--L--S--Q--K--G--P--F--W--T--W--E

                                                           
GCCTAGTGCCCCTCGAACTCTGCTCCAGGTCCTACAGGATCCAGCCCTGAAAGACCTCGT
--P--S--A--P--R--T--L--L--Q--V--L--Q--D--P--A--L--K--D--L--V

                                                           
CCTCACCTGCCCCACCCTGCCCTGGCATTCCCTGATCCTGCGGCCCCAGTATGAGATCCA
--L--T--C--P--T--L--P--W--H--S--L--I--L--R--P--Q--Y--E--I--Q

                                                           
AGCCATCATGCACATGCGCAGGACCATTGTCAAGATCCCTTCTACCCTGGAGGTCGACGT
--A--I--M--H--M--R--R--T--I--V--K--I--P--S--T--L--E--V--D--V

                                                           
GGAGGACGTCACCGCCTCCTCCCGGCACGTCCACTTTATCAAACCGCTGCTGCTGAGCGA
--E--D--V--T--A--S--S--R--H--V--H--F--I--K--P--L--L--L--S--E

                                                           
GCGGCTGAGTGACCAGGCTGGGGAGGATGAGGAGGAAGAGTGCAAAGAGGAGGCAGAGAG
--R--L--S--D--Q--A--G--E--D--E--E--E--E--C--K--E--E--A--E--S

                                           S               
CCCAGAGCGGGTCCTGCTGCCCTTCCACTTCCCTGGCAGTTTCGTGGAGGAGATGAGTGA
--P--E--R--V--L--L--P--F--H--F--P--G--S--F-=V=-E--E--M--S--D

                                                           
CAGCCGGCGCTACAGCCTGGCAGATCTGACTGCCCAGTTTTCACTGCCTTGTGAGGTCAA
--S--R--R--Y--S--L--A--D--L--T--A--Q--F--S--L--P--C--E--V--K

                                                           
GGTGGTGGCCAAGGACACCAGCCACCCCACTGACCCTCTGACCTCCTTCCTGGGCCTGCG
--V--V--A--K--D--T--S--H--P--T--D--P--L--T--S--F--L--G--L--R

                                        R                
GCTGGAGGAGAAGATCACAGAGCCATTCTTGGTGGTGAGCCTAGACTCTGAGCCTGGGAT
--L--E--E--K--I--T--E--P--F--L--V--V--S--L--D--S--E--P--G--M

                                       Y   R               
GTGCTTTGAGATCCCTCCCCGGTGGCTGGACCTGACTGTTGTGAAGGCCAAGGGGCAGCC
--C--F--E--I--P--P--R--W--L--D--L--T--V--V-=K=-A--K--G--Q--P

                                                           
AGACTTGCCAGAGGGGTCTCTCCCCATAGCCACAGTGGAGGAGCTGACAGACACCTTCTA
--D--L--P--E--G--S--L--P--I--A--T--V--E--E--L--T--D--T--F--Y

                                                           
TTATCGTCTTCGGAAGTTACCAGCCTGTGAGATCCAAGCCCCCCCACCCAGGCCCCCTAA
--Y--R--L--R--K--L--P--A--C--E--I--Q--A--P--P--P--R--P--P--K

                                                           
AAATCAGGGCCTCAGCAAGCAGAGGAGACACAGCAGTGAGGGAGGCGTCAAGTCTTCTCA
--N--Q--G--L--S--K--Q--R--R--H--S--S--E--G--G--V--K--S--S--Q

                       Y                                   
AGTCTTAGGATTGCAGCAACACGCTCGGCTGCCCAAACCCAAGGCGAAGACCTTGCCAGA
--V--L--G--L--Q--Q--H-=A=-R--L--P--K--P--K--A--K--T--L--P--E

                                                           
GTTCATCAAGGATGGCTCCAGTACGTACAGCAAGATTCCTGCCCACAGGAAGGGCCACAG
--F--I--K--D--G--S--S--T--Y--S--K--I--P--A--H--R--K--G--H--R

                                                           
GCCCGCTAAGCCCCAAAGGCAGGATCTAGATGATGATGAACATGATTATGAAGAAATACT
--P--A--K--P--Q--R--Q--D--L--D--D--D--E--H--D--Y--E--E--I--L

                                                           
TGAGCAATTTCAGAAAACCATCTAAGTGCTGGAGGAACCACGCTTCCTAACTGCTGCTTC
--E--Q--F--Q--K--T--I--*-...................................

                                                           
TCAGGGAATCCGACACCAGCCAACCATTTTAAGCCTCTAAAAGACCTCGGGCAAGTCTCA
............................................................

                                                           
CAGAAACTGAGCTGCAGACGGGGAGTAGCTTTGTGGAAACTGATTTGATGGACACTGCAC
............................................................

                                                           
CAGCTTCCTTCAGGTTCTAGATTCTTGCTACTTAGGGCGGGCTGGTTTGGACCTAACATC
............................................................

                                                           
TCGCACGTGACTCCCTCAGCCTCAGAGCCTTGGGATGCAGAGCAGCTGGCAGGGTTCCTC
............................................................

                                                           
TCAATCCTGCAACCCCAGCTGTCCCACCGGTGGATGCAGAGGGGAATCCGAGGCCATCAA
............................................................

                                     Y                     
CCTTGGTGACAGCAGCGCAGTGCCAATGCTGATCACACTGCATGGGAGATTTTGTTAACG
............................................................

                                                  M        
TCTGCCACCCCCACTCTCACCCCCAAGCTCTAAGCCCCCGGGAGGCCTGGACTGTCTTCC
............................................................

                                                           
TCATCTCTGTAGCACCAAGCCTGATAGATCTGTATATGGTAAACAGGGGTTTAACCACAT
............................................................

                          Y                                
GTGGTTAACATGGATTAATGTGGGAACTTGGCTTCAAGAACACAACCTTAGGACCTTGGG
............................................................

                                                          
CCCCAAAAGCTGGTGGTGAAATGAGGAGGAGCCAATTTAAGAAGACCCTTATGGAGACCT
............................................................

    M                                                      
GAGGCTGCAGAAACTGGTAGGTTTCATCAGGTGGTTAAAGTCGTCAAAGTTGTAAGTGAC
............................................................

                            Y                              
TAACCAAGATTATTTCATTTTAAAACCATAGAATAAAAATGACACCTGAGCTTCTCTATG
............................................................

       
AATGAGAA
.......

 

 

 ICB-1Splice-Varianten

    

 

Kontaktieren Sie uns

Prof. Dr. rer. nat.
Oliver Treeck
Leiter der Arbeitsgruppe "Molekulare Onkologie"     
Universität Regensburg
 
Telefon (Labor) 0941 943-6196
Telefon (Büro) 0941 782-7520
Fax 0941 782-7515
Mail otreeck@caritasstjosef.de

 

Kontakt Anfahrt Seite drucken© 2002-2017 Caritas-Krankenhaus St. Josef | Impressum | Sitemap | Design & Programmmierung